PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA05G07370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 511aa    MW: 57819.2 Da    PI: 7.5357
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA05G07370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.27.1e-3151101151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+
  ONIVA05G07370.1  51 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 101
                      79***********************************************95 PP

2SRF-TF82.23.3e-26316364351
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      ie++  rqvtf+kR ng+lKKA+ELS LCdaeva+i+fss+g+lyeys+
  ONIVA05G07370.1 316 IEDTADRQVTFCKRCNGLLKKAYELSMLCDAEVALIVFSSRGRLYEYSN 364
                      99*********************************************95 PP

3K-box103.52.7e-341192154100
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      s+ + + e +a+++qqe+akLk++i nLq+ +R l+G++++s++++eL+qLe +L+k+l kiR++Knell+++ie++q++e elq++n++L++k
  ONIVA05G07370.1 119 SNASTVVEINAQHYQQEAAKLKQQITNLQNANRTLVGDNITSMNHRELKQLEGRLDKGLGKIRARKNELLCAEIEYMQRRETELQNDNMYLKSK 212
                      3344488999************************************************************************************ PP

            K-box  98 lee 100
                      ++e
  ONIVA05G07370.1 213 VAE 215
                      986 PP

4K-box45.63e-16382471495
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLsl.keLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                      s+ + ++e +a+++qqe+akLk+ i  Lq+++R ++  +L+ L++  +L ++  +L  +l+kiR++Kne+++++ie++q++e elq++n++ +
  ONIVA05G07370.1 382 SNASTVAEINAQHYQQEAAKLKQHITYLQNSNRFII--SLSCLDFfFQLDKVV-HLVIGLEKIRARKNEYMCAEIEYMQRRETELQNDNMYSK 471
                      44444999**********************977765..788777524666664.5889*******************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-3943102IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.42243103IPR002100Transcription factor, MADS-box
CDDcd002654.34E-4345117No hitNo description
PRINTSPR004045.6E-324565IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-3245115IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004599IPR002100Transcription factor, MADS-box
PfamPF003193.0E-265299IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-326580IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-3280101IPR002100Transcription factor, MADS-box
PfamPF014867.4E-26128213IPR002487Transcription factor, K-box
PROSITE profilePS5129714.685129219IPR002487Transcription factor, K-box
SMARTSM004323.6E-24306365IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.385306366IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.19E-24315378IPR002100Transcription factor, MADS-box
PfamPF003191.4E-23316362IPR002100Transcription factor, MADS-box
CDDcd002654.74E-32316380No hitNo description
PfamPF014868.2E-10391468IPR002487Transcription factor, K-box
PROSITE profilePS512977.384392480IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MHIYKEQEAE PSTGLMMPEP APVASPGSGG SGGSGSVGAE KIGSRGKIEI KRIENTTNRQ  60
VTFCKRRNGL LKKAYELSVL CDAEVALVVF SSRGRLYEYS NNSVKETIER YKKANSDTSN  120
ASTVVEINAQ HYQQEAAKLK QQITNLQNAN RTLVGDNITS MNHRELKQLE GRLDKGLGKI  180
RARKNELLCA EIEYMQRRET ELQNDNMYLK SKVAESERGL QTVNMMGSAS TSEYVQNMIH  240
YDPRNFLQFN IMHQPQYYPE QEDRKAFMSG LALSREDLAI MHIYKEQEAE PSTGLMMPEP  300
APAASPGSGS SEGSGIEDTA DRQVTFCKRC NGLLKKAYEL SMLCDAEVAL IVFSSRGRLY  360
EYSNNSVEET IERYKKANSD TSNASTVAEI NAQHYQQEAA KLKQHITYLQ NSNRFIISLS  420
CLDFFFQLDK VVHLVIGLEK IRARKNEYMC AEIEYMQRRE TELQNDNMYS KSERTANSEH  480
DGLSIYERVR AKYDPLRSKK LPAIQYHAAA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-1845378172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-1845378172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-1845378172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-1845378172MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-1845393190Myocyte-specific enhancer factor 2A
3p57_I3e-1845393190Myocyte-specific enhancer factor 2A
3p57_D3e-1845393190Myocyte-specific enhancer factor 2A
3p57_C3e-1845393190Myocyte-specific enhancer factor 2A
3p57_B3e-1845393190Myocyte-specific enhancer factor 2A
3p57_A3e-1845393190Myocyte-specific enhancer factor 2A
3kov_J3e-1845393190Myocyte-specific enhancer factor 2A
3kov_I3e-1845393190Myocyte-specific enhancer factor 2A
3kov_B3e-1845393190Myocyte-specific enhancer factor 2A
3kov_A3e-1845393190Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2321570.0AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankFJ7509420.0FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638060.10.0PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P10.0MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0E0HAW60.0A0A0E0HAW6_ORYNI; Uncharacterized protein
STRINGLOC_Os05g11414.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.12e-91MIKC_MADS family protein